wtwschool.co.uk >> Home | Walnut Tree Walk Primary School

What sites are similar to this one?

Home | Walnut Tree Walk Primary School

School Website is the UK's leading provider of school web site design, prospectus design, branding, multimedia and marketing for education.

wtwschool.co.uk's domain statistics have been assessed with data provided by cloud computing providers. Additionally, cloud security information may be pulled from the host server or private cloud that Amazon.com registered with.

This is a free and comprehensive report about wtwschool.co.uk. wtwschool.co.uk is hosted in on a server with an IP address of The website wtwschool.co.uk is expected to be earning an estimated $22 USD on a daily basis. The sale of wtwschool.co.uk would possibly be worth $8,307 USD. This figure is based on the daily revenue potential of the website over a 12 month period. According to our google pagerank analysis, the url wtwschool.co.uk currently has a pagerank of 0/10. wtwschool.co.uk possibly receives an estimated 2,094 unique visitors every day.

wtwschool.co.uk information and statistics

Website / Domain: wtwschool.co.uk
Website IP :
Alexa Rank : 14562739
Google PageRank : 0
DNS Server : ns.123-reg.co.uk,ns2.123-reg.co.uk

wtwschool.co.uk traffic and earnings

Purchase/Sale Value : $ 8,307
Daily Revenue : $ 22
Monthly Revenue : $ 682
Yearly Revenue : $ 8,307
Daily Unique Visitors : 2,094
Monthly Unique Visitors : 62,820
Yearly Unique Visitors : 764,310

wtwschool.co.uk traffic graph (6 month period)

wtwschool.co.uk alexa traffic graph (6 month period)

wtwschool.co.uk Traffic Sources

wtwschool.co.uk Traffic Sources
search engines social networks ad campaings direct traffic other
2094 1047 377 356 209 105

wtwschool.co.uk Cloud server address

Country :
Country code :
Region :
Region code :
City :
Zip Code :
Timezone :
Organization :
AS number/name :

What sites are similar to this one?

Domain description
wtwschool.co.ukHome | Walnut Tree Walk Primary School
silvertreeprimary.co.ukHome | Silver Tree Primary School
yewtreeprimary.co.ukYew Tree Primary School
walnuttreeworlington.co.ukThe Walnut Tree - Home
the-walnut-tree.co.ukThe Walnut Tree - Home
walnut-tree-inn.co.ukHome - The Walnut Tree Inn Mere
figtreeprimary.co.ukFig Tree Primary School review | School Guide
lime-tree.org.ukLime Tree Primary School - Our School
thewalnuttreemaidstone.comThe Walnut Tree
treviskerprimaryschool.co.ukTrevisker Primary School | Home : Trevisker Primary School
walnutgrovehigh.orgwalnut grove high school - home
walnuthilldayschool.netWalnut Hill Day School - Home
primarycarewalkinmedicalclinic.comPrimary Care Walk-in Medical Clinic - Home
newlandsprimary.co.ukhome | newlands primary school
brunswickprimaryschool.co.ukBrunswick Primary School - Home
woodlandsschoolformby.co.ukHome | Woodlands Primary School
straitsprimaryschool.comHome | Straits Primary School
kinetonprimaryschool.org.ukKineton Primary School - Home
leighprimaryschool.comLeigh Primary School - Home
marlboroughschool.netMarlborough Primary School - Home